PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00029704-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family GRAS
Protein Properties Length: 574aa    MW: 65583.7 Da    PI: 5.1703
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00029704-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS270.84.3e-832085711373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPi 90 
                         l +lLl++Ae v  ++ e+a+++L r +  +s +g+p qR++ +f+eAL++r+ + s+  ++k ++ +++   +  +++  + + ++  P+
  WALNUT_00029704-RA 208 LAHLLLAAAEKVGYQQYERAERMLLRCEWVSSARGNPAQRVIYHFAEALRERIEKeSGRVTMKGFEEKDEI-VQGLTNTPTFLINYKQLPF 297
                         579****************************************************4555555555555444.33444445555678899** PP

                GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          ++  +t  q+++e +++e++vH iD +i +G++W  L+qaLa+R+  +   l+iT+vgs      + +ee+g rLa+fA++l++pf+f+ 
  WALNUT_00029704-RA 298 TQVLVFTGIQTMVETIASERKVHLIDTGIRYGVHWTVLMQALADRQdYPIELLKITAVGS------TDIEEIGTRLASFAKSLNLPFSFKS 382
                         *********************************************9566679********......89*********************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         ++ ++++d + e +++++gE++++   + l ++   + sle+    +++++++l+P+++vv e+e +hns+sF++rf++al yysa ++sl
  WALNUT_00029704-RA 383 VILSDMKDAKEELFETEEGETIIIYAPYVLRTMIPTPDSLEN----LMRVMRNLNPTMMVVFESEGNHNSPSFVNRFTDALFYYSAYYESL 469
                         **********************************88888888....********************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                         ++ + + +e+ri +E + +g +i+n+va eg+er+ r   l  Wr+ ++++G+ ++ +se+  kqa+l+l+k++     +++ + +slv g
  WALNUT_00029704-RA 470 DTCMKQYDEDRIRLETV-FGDAIRNIVAEEGEERTIRSVPLDVWRAYFGRFGMVEIGISESSFKQASLVLQKFDcRSCCTIHRNGKSLVVG 559
                         ***************99.********************************************************8888************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         Wk+ p+ s+S+W
  WALNUT_00029704-RA 560 WKGTPIHSLSVW 571
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.809182551IPR005202Transcription factor GRAS
PfamPF035141.5E-80208571IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MADTFFSFTP YLDGIQENYG PLEDFRKEEA QFKEKRDHLI DMEMGEANPN EYGFHQGEMA  60
KKVDYFLKDK LLIQHQQPID EFHFNALSPT TQPIQESAGL VHIPARVSET SENNTQMPHP  120
SPLASPLKLL TNYGSGFKKL KGEKLIKVET ETSGTSDKLS TVEIMKVAGA RYVQFSTQMC  180
DDYNYMAMHP FGFALSCLSD DDKRDVELAH LLLAAAEKVG YQQYERAERM LLRCEWVSSA  240
RGNPAQRVIY HFAEALRERI EKESGRVTMK GFEEKDEIVQ GLTNTPTFLI NYKQLPFTQV  300
LVFTGIQTMV ETIASERKVH LIDTGIRYGV HWTVLMQALA DRQDYPIELL KITAVGSTDI  360
EEIGTRLASF AKSLNLPFSF KSVILSDMKD AKEELFETEE GETIIIYAPY VLRTMIPTPD  420
SLENLMRVMR NLNPTMMVVF ESEGNHNSPS FVNRFTDALF YYSAYYESLD TCMKQYDEDR  480
IRLETVFGDA IRNIVAEEGE ERTIRSVPLD VWRAYFGRFG MVEIGISESS FKQASLVLQK  540
FDCRSCCTIH RNGKSLVVGW KGTPIHSLSV WGFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3324257137374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346627.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLF6HZA20.0F6HZA2_VITVI; Putative uncharacterized protein
STRINGVIT_07s0005g01500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-51RGA-like 1